PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G217700.1
Common NamePOPTR_0010s22470g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 214aa    MW: 23262.4 Da    PI: 6.0874
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G217700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.13.1e-43601591100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i++lq+q++ l+
  Potri.010G217700.1  60 PCAACKILRRRCVDKCVLAPYFPPSEPYKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARIRDPVYGCAGAISQLQKQVSDLQ 150
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         a+la++++e
  Potri.010G217700.1 151 AQLAKAQAE 159
                         ****99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.05859160IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-4360157IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MDMIEQSAAI SPINVPSQFS YSPSSSSPPS SHHSSPSKSS PNLTPPSAAT PPPPPPVVSP  60
CAACKILRRR CVDKCVLAPY FPPSEPYKFT IAHRVFGASN IIKFLQELPE SQRADAVSSM  120
VYEANARIRD PVYGCAGAIS QLQKQVSDLQ AQLAKAQAEV VNMQCQQANL VALLCMEMTQ  180
SQQEPILQQH QYVDTSCFLD ENNLGTSWEP LWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ2841650.0HQ284165.1 Populus tremula x Populus alba lateral organ boundaries domain 1 (LBD1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002315279.11e-155LOB domain protein 11
SwissprotQ9LQR01e-73LBD1_ARATH; LOB domain-containing protein 1
TrEMBLB9HU241e-155B9HU24_POPTR; LOB domain protein 11
STRINGPOPTR_0010s22470.11e-155(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.15e-68LOB domain-containing protein 1